DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG30414

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:309 Identity:104/309 - (33%)
Similarity:148/309 - (47%) Gaps:49/309 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLIPALLALLI----LGHGISLGYSYLLEWDCGISK--YTYRITGGRDSPLMLNPWLAYLHINS 59
            ||.|.|.||||:    ||.|..   .:||:..||.:|  :...||||.|:.|..|||:  :.:..
  Fly     1 MKFIAAGLALLVCSIQLGEGAP---GHLLDSSCGTTKPEFIPMITGGADAGLFSNPWM--VKVLG 60

  Fly    60 KFICGGSLLNHWFVLTAAHCFRDKNAKVLVRLGE-------NDASQKI----------------- 100
            :.:|||||:...||||||||....:.:  |||||       .|.|:.:                 
  Fly    61 EKLCGGSLITSRFVLTAAHCIVSTHMR--VRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTR 123

  Fly   101 ----DCNESECAAPHLEYMIMQKLIHPLYRTAHYYDIALAKLNRYVVYTDSIRPICLMLNPNWQV 161
                ||    |.....|..:.:|::|..|......||.|.::..:|.|:|.:|||||::    :.
  Fly   124 FPGKDC----CVPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLLV----EG 180

  Fly   162 YVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHYVGKGDS 226
            ::.....|.|||||.||....|.:||...:...|...||..|...||.:.|||..:......|||
  Fly   181 HMAESPIFNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDS 245

  Fly   227 GGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGVSVFTNILSYSNWIHRTI 275
            ||||.:.|.:..:...||:|:||:.....|..||:||:..:.:||...|
  Fly   246 GGPLSAQVPFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 85/261 (33%)
Tryp_SPc 38..274 CDD:238113 87/263 (33%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 85/260 (33%)
Tryp_SPc 41..290 CDD:238113 85/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.