DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG9897

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:306 Identity:78/306 - (25%)
Similarity:123/306 - (40%) Gaps:85/306 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIPALLALLILGHGISLGYSYLLEWDCGISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSL 67
            |.|.:|..::....::||              ..||..|....:...||.|.:.:|||..|||::
  Fly     2 LAPLILLQIVALPWLALG--------------DQRIINGNTVNIKDAPWYASIIVNSKLKCGGAI 52

  Fly    68 LNHWFVLTAAHCFRDKNAK-VLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHY- 130
            ::..::||||.|....:|: :.||||.:      .|..|...|.     |.:..:|..|.:..: 
  Fly    53 ISKNYILTAAKCVDGYSARSIQVRLGTS------SCGTSGSIAG-----ICKVKVHSQYSSWRFD 106

  Fly   131 YDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATN------------ASEVS 183
            .::||.|....:..||.|:||    ....:|..|..| ..:||.|..:            :|.:.
  Fly   107 NNLALLKTCELLNTTDEIKPI----ERADKVPDDNSR-ANVTGCGGRSGNFLDLILDLRISSGIE 166

  Fly   184 DK-----LQL--TRIPQIDRFTCR--------YWFGYMVDRTHICAGESKHYVGKG----DSGGP 229
            :|     :||  |::..:.:..|.        |....:.|.| ||....    |||    |.|.|
  Fly   167 EKCFQLPVQLHGTQVRILSQKQCAADWKVIPFYLLKGISDLT-ICTKSP----GKGACSTDRGSP 226

  Fly   230 LGSMVDYKYAKRFFQFGIVSHLRQPFHGVS----VFTNILSYSNWI 271
            |  ::|.|..      ||:|..     |.|    |:.|||.::||:
  Fly   227 L--VIDNKLV------GILSRA-----GCSIKPDVYANILGHTNWL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 72/270 (27%)
Tryp_SPc 38..274 CDD:238113 72/271 (27%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 71/269 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.