DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and Prss56

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_003750778.1 Gene:Prss56 / 363274 RGDID:1563955 Length:607 Species:Rattus norvegicus


Alignment Length:252 Identity:74/252 - (29%)
Similarity:110/252 - (43%) Gaps:40/252 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKVL--VRLGENDASQK 99
            ||.||..:||...|||..|.:....:|||.|:...:||||||||...:.::|  |.|.|....::
  Rat   111 RIVGGSTAPLGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASNELLWTVMLAEGPQGEQ 175

  Fly   100 IDCNESECAAPHLEYMIMQKLIHPLY--RTAHYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVY 162
            .:           |..:.:.|.||.:  :|.| .|:||.:|...|......|||||   |.....
  Rat   176 AE-----------EVQVNRILPHPKFDPQTFH-NDLALVQLWTPVNSEGPARPICL---PEGSRE 225

  Fly   163 VDTIRYFIITGWGAT-NASEVSDKLQLTRIPQIDRFTCRYWFG-YMVDRTHICAGESKHYVG--- 222
            ........|.||||. .....|:.::..|:|.:...||:...| .:...|.:|||   :..|   
  Rat   226 PPAGTPCTIAGWGALFEDGPESEAVREARVPLLSADTCQKALGPGLSPSTMLCAG---YLAGGID 287

  Fly   223 --KGDSGGPLGSMVDYKYAKRFFQFGIVS------HLRQPFHGVSVFTNILSYSNWI 271
              :||||||| :..:.....|...||:.|      ...:|    .|:|.:..:.:|:
  Rat   288 SCQGDSGGPL-TCSEPGPRPREVLFGVTSWGDGCGEPGKP----GVYTRVAVFKDWL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 73/250 (29%)
Tryp_SPc 38..274 CDD:238113 73/251 (29%)
Prss56XP_003750778.1 Tryp_SPc 112..342 CDD:238113 73/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352879
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.