DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and Prrg2

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_008757618.1 Gene:Prrg2 / 361570 RGDID:1305444 Length:198 Species:Rattus norvegicus


Alignment Length:143 Identity:27/143 - (18%)
Similarity:46/143 - (32%) Gaps:52/143 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 AKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHYYDIALAKLNRYVVYTDSIR 149
            |..|..|...:.||.:|.   ...||..:..::.:...|   .|:::|:.|       :...::.
  Rat    15 ATCLDTLPHREQSQVLDI---FLDAPEAQSFLVGRRRFP---RANHWDLEL-------LTPGNLE 66

  Fly   150 PICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICA 214
            ..||....:|:   :...||                       :.:..|.|:|            
  Rat    67 RECLEERCSWE---EAREYF-----------------------EDNTLTERFW------------ 93

  Fly   215 GESKHYVGKGDSG 227
             ||..|.|||..|
  Rat    94 -ESYAYNGKGGRG 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 27/143 (19%)
Tryp_SPc 38..274 CDD:238113 27/143 (19%)
Prrg2XP_008757618.1 GLA 33..96 CDD:214503 15/111 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.