DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG1773

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_610512.1 Gene:CG1773 / 35999 FlyBaseID:FBgn0033439 Length:317 Species:Drosophila melanogaster


Alignment Length:276 Identity:95/276 - (34%)
Similarity:134/276 - (48%) Gaps:33/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LGYSYLLEWDCGI-------SKYTYRITGGRDSPLMLNPWLAYLHINSKF---ICGGSLLNHWFV 73
            |.|..|.:.|||:       .:...||||||.|.|:..||:|:|||:...   .||||||:..||
  Fly    36 LAYEQLTQQDCGVLSNLIPAQRLRRRITGGRKSSLLSQPWMAFLHISGDIEMCRCGGSLLSELFV 100

  Fly    74 LTAAHCFR--DKNAKVLVRLGENDASQKIDC----NESECAAPHLEYMIMQKLIHPLYRTAH-YY 131
            |||||||:  .::.::.|.|||.|.|...||    .:..||.|..|:.|.:.::|..:...: .|
  Fly   101 LTAAHCFKMCPRSKEIRVWLGELDISSTSDCVTYNYQRVCALPVEEFTIDKWILHEEFNLFYPGY 165

  Fly   132 DIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTI-RYFIITGWGATNASEVSDKLQLTRIPQID 195
            ||||.|||:.||:.|.||||||.|......:...: :.::..|||.|.:...::.   |....|:
  Fly   166 DIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQSYMAVGWGRTESRRFANS---TMEVHIN 227

  Fly   196 RFTC---RYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHG 257
            ...|   |       |.:.:||.........|||||||..........|..|||:||...|....
  Fly   228 TEKCTDGR-------DTSFLCANGDYVDTCTGDSGGPLIWKTTLFGKARTVQFGVVSTGSQNCGA 285

  Fly   258 --VSVFTNILSYSNWI 271
              .:.:.::.:|..||
  Fly   286 GQKAYYMDVPTYVPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 87/249 (35%)
Tryp_SPc 38..274 CDD:238113 88/250 (35%)
CG1773NP_610512.1 Tryp_SPc 61..301 CDD:214473 87/249 (35%)
Tryp_SPc 62..301 CDD:238113 86/248 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.