DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and f9a

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_878288.2 Gene:f9a / 359826 ZFINID:ZDB-GENE-030714-2 Length:503 Species:Danio rerio


Alignment Length:259 Identity:78/259 - (30%)
Similarity:121/259 - (46%) Gaps:31/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGRDSPLMLNPWLAYLHINS--KFICGGSLLNHWFVLTAAHC-FRDKNAKVLVRLGENDASQ 98
            ||.||..:.....||...|...|  :..||||:||..:|:||||| ..:.|....:|:||:|.| 
Zfish   253 RIIGGNSALPGEIPWQVALVSRSTQQVFCGGSILNPLWVITAAHCLLGNHNGSFYIRVGEHDVS- 316

  Fly    99 KIDCNESECAAPHLEYMIMQKLIHPLYR---TAHYYDIALAKLNRYVVYTDSIRPICL--MLNPN 158
            ||:..|....       :::.:.||.|.   :...:||||.:|...:..|.::|||||  |:..|
Zfish   317 KIEGTEQNVD-------VIKLISHPRYNSKVSLFNHDIALLRLRSPIRLTPTVRPICLGPMVFSN 374

  Fly   159 WQVYVDTIRYFIITGWGATN-ASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAG--ESKHY 220
            ..:...|:.  .::|||... ....:..||...:|.:||..|:......:.....|||  :|...
Zfish   375 TLLQSGTLA--TVSGWGRVRFQGRSAATLQKIELPYVDRTVCKESSSDPITHFMFCAGHSDSPKD 437

  Fly   221 VGKGDSGGPLGSMVDYKYAKRFFQFGIVSH----LRQPFHGVSVFTNILSYSNWIHRTIITNSG 280
            ..:||||||    ...:|...:|..||:|.    .::..:|  |:|.:.:|..||..|:...:|
Zfish   438 ACQGDSGGP----HVMRYHNTWFLTGIISWGEECAKKGKYG--VYTQVGNYYRWIQHTMGVTTG 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 74/248 (30%)
Tryp_SPc 38..274 CDD:238113 75/250 (30%)
f9aNP_878288.2 GLA 19..83 CDD:214503
EGF_CA 84..120 CDD:238011
FXa_inhibition 127..163 CDD:291342
Tryp_SPc 253..486 CDD:214473 74/248 (30%)
Tryp_SPc 254..489 CDD:238113 75/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.