DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG14227

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:296 Identity:102/296 - (34%)
Similarity:145/296 - (48%) Gaps:31/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLIPALLAL---LILGHGISLGYSYLLEWDCGIS-----KYTYRITGGRDSPLMLNPWLAYLHIN 58
            |:|.|||.|   |.||.  ..|.::||:.:||.|     |.|:.......:.:..|||:..:.:|
  Fly     3 KVIAALLILFASLFLGS--REGSAFLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVIVN 65

  Fly    59 SKFICGGSLLNHWFVLTAAHC-FRDKNAKVLVRLGENDA-SQKIDCNESECAAPHLEYMIMQKLI 121
            .|..|.|||:||.|||||||| ||:   .:.|.||:.|| :...:|:.....:......|.:|::
  Fly    66 GKAKCSGSLINHRFVLTAAHCVFRE---AMQVHLGDFDAWNPGQNCSSGARLSNAYCVRIDKKIV 127

  Fly   122 HPLYR--TAHYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSD 184
            |..:.  .|..|||.|.::...|.|:|.:|||||::|..    |..|..|.:|.||.|    ..|
  Fly   128 HAGFGKIQAQQYDIGLLRMQHAVQYSDFVRPICLLINEP----VAAIDRFQLTVWGTT----AED 184

  Fly   185 KLQLTRI------PQIDRFTCRYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFF 243
            ...:.|:      .:|||..|...|...||.:.||......:..|||||||..:.:.|....|.|
  Fly   185 FRSIPRVLKHSVGDRIDRELCTLKFQQQVDESQICVHTETSHACKGDSGGPFSAKILYGGTYRTF 249

  Fly   244 QFGIVSHLRQPFHGVSVFTNILSYSNWIHRTIITNS 279
            ||||:........|:||.||:..|.:||...::..|
  Fly   250 QFGIIIFGLSSCAGLSVCTNVTFYMDWIWDALVNLS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 82/243 (34%)
Tryp_SPc 38..274 CDD:238113 84/245 (34%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 81/230 (35%)
Tryp_SPc 57..277 CDD:238113 81/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.