DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and Ser7

DIOPT Version :10

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster


Alignment Length:288 Identity:88/288 - (30%)
Similarity:133/288 - (46%) Gaps:54/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGISKYTYRITGGRDSPLMLNPWLAYLHINS-----KFICGGSLLNHWFVLTAAHCF----RDKN 84
            || |.:::|:.||.::.|...||...|...:     .:.||.|.:...::||||||.    |:..
  Fly   124 CG-SAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLT 187

  Fly    85 AKVLVRLGENDASQKIDCNES-----ECAAPHLEYMIMQKLIHPLYRTAHY-YDIALAKLNRYV- 142
            |.:   |||.:.....||...     |||.||:...|.:.|.|..|...:| .||||.:|:|.| 
  Fly   188 AAI---LGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVN 249

  Fly   143 -VYTDSIRPICLMLNPNWQVYVDTIRYFI--ITGWGAT---NASEVSDKLQLTRIPQIDRFTCRY 201
             :...::.|:|  |.|....|.:.:....  ::|||.|   .:|::..|..|...|| |:  |:.
  Fly   250 WLQMQNLEPVC--LPPQRGRYANQLAGSAADVSGWGKTESSGSSKIKQKAMLHIQPQ-DQ--CQE 309

  Fly   202 WFGY------MVDRTHICAGESKHYVG----KGDSGGPLGSMVDYKYAKRF-FQFGIVSHLRQP- 254
            .| |      :.| :.:|||..   :|    .|||||||....:.....|: :..|:||..|:. 
  Fly   310 AF-YKDTKITLAD-SQMCAGGE---IGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHC 369

  Fly   255 ----FHGVSVFTNILSYSNWIHRTIITN 278
                |.|  ::|.:.||.:||..||..|
  Fly   370 GTALFSG--IYTRVSSYMDWIESTIRAN 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 38..274 CDD:238113 81/273 (30%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 133..391 CDD:238113 81/272 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.