DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG18636

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:275 Identity:98/275 - (35%)
Similarity:147/275 - (53%) Gaps:7/275 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IPALLALLILGHGISLGYSYLLEWDCGI---SKYTYRITGGRDSPLMLNPWLAYLH-INSKFICG 64
            :|..:.::::...:..|.|..|:..|||   |:..|||..|..:....:||:.:|| ....|:||
  Fly     8 VPTFVGIILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCG 72

  Fly    65 GSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLY-RTA 128
            |||:....|||||||| ..|..::.||||.:.::..:|....|.... |:|:.....|.|| ...
  Fly    73 GSLITDKLVLTAAHCF-IANQHLVARLGEYERTRSEECTGYYCNFRE-EHMVDAGFKHKLYDPNT 135

  Fly   129 HYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQ 193
            |..|||:.:|::.|||.|:|||||::.:..|:.|:|.|.....||||.|.....||.||...|.:
  Fly   136 HANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRR 200

  Fly   194 IDRFTCRYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGV 258
            .....|..:.|..:.....|||.....:..||||||||:::.:|..:||.|.||.|:..:.....
  Fly   201 QPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQKA 265

  Fly   259 SVFTNILSYSNWIHR 273
            ||||::||::.:|.|
  Fly   266 SVFTDVLSHAEFILR 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 87/235 (37%)
Tryp_SPc 38..274 CDD:238113 88/238 (37%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 87/235 (37%)
Tryp_SPc 45..278 CDD:238113 86/234 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.