DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG33226

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:270 Identity:96/270 - (35%)
Similarity:141/270 - (52%) Gaps:16/270 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SLGYSYLLEWDC-----GISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAA 77
            |||.. ||:.:|     |:.:   :|.||.::.:.|:||:..:.......|||||::..||||||
  Fly    26 SLGQD-LLDPNCVQTPVGVRE---QILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLFVLTAA 86

  Fly    78 HCFRDKNAKVLVRLGE-NDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHYYDIALAKLNRY 141
            ||  ....::.||.|. :..:.:..|:...|:....|..:.:..:|..||..|.|||||..|.:.
  Fly    87 HC--HSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNYDIALFLLAKP 149

  Fly   142 VVYTDSIRPICLMLNPN---WQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWF 203
            |.|....||||::...|   .:.:::.:..|.:||||.|.:...|..||.|.:..:||..|...|
  Fly   150 VRYNVQTRPICVLQTSNKDKLRQFLNYVAMFNVTGWGKTESQLTSTILQTTSLFHLDRKFCAQIF 214

  Fly   204 GYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGVSVFTNILSYS 268
            ...:...|||||.|:.....|||||||.:.:.:...||...|||:|:.......|:||||:|.||
  Fly   215 DRKIGWPHICAGHSQSSTCTGDSGGPLSAELTFSGVKRTVLFGIISYGAPNCREVTVFTNVLRYS 279

  Fly   269 NWIHRTIITN 278
            ||| |.|:.|
  Fly   280 NWI-RDIVHN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 84/237 (35%)
Tryp_SPc 38..274 CDD:238113 86/239 (36%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 87/240 (36%)
Tryp_SPc 47..282 CDD:214473 84/236 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.