DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG33462

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:264 Identity:89/264 - (33%)
Similarity:133/264 - (50%) Gaps:18/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GYSYLLEWDCGISKYTYRIT-GGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDK 83
            |:..|||.||||   .:.|: ...::.|..|||:|||.....|.|.|:|:||.||||||||..| 
  Fly    20 GFQMLLEEDCGI---PHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPD- 80

  Fly    84 NAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHYY-------DIALAKLNRY 141
            :..:.|||||.:...|:||:...|..|..||.:.....|      .||       ||.:.:|.|.
  Fly    81 DLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRH------RYYNANDQTNDIGMLRLGRR 139

  Fly   142 VVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWFGYM 206
            |.|.:.|||||:..:..:|..:|.:.:|..|.|..|.|:..|..|:...|.:..:.||...:|:.
  Fly   140 VEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWN 204

  Fly   207 VDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGVSVFTNILSYSNWI 271
            :....||||.:...:...|||.|....:.:..:.|:.|.||.|.::.......:..::|||::||
  Fly   205 MTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGILMDLLSYADWI 269

  Fly   272 HRTI 275
            .|.:
  Fly   270 KRVV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 78/241 (32%)
Tryp_SPc 38..274 CDD:238113 80/243 (33%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 77/230 (33%)
Tryp_SPc 48..269 CDD:214473 75/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.