DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and Proc

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_008770240.3 Gene:Proc / 25268 RGDID:3411 Length:500 Species:Rattus norvegicus


Alignment Length:268 Identity:87/268 - (32%)
Similarity:121/268 - (45%) Gaps:59/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGRDSPLMLNPWLA-YLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKI 100
            ||..|..:....:||.| .|....|..|||.|::..:|||||||. :.:.|:.|||||.|..:: 
  Rat   251 RIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCL-ESSKKLTVRLGEYDLRRR- 313

  Fly   101 DCNESECAAP-HLEYMIMQKLIHPLY-RTAHYYDIALAKLNRYVVYTDSIRPICLMLNPN----- 158
                    .| .|:..|.:.|:||.| |:....||||.:|::....:.:|.||||   ||     
  Rat   314 --------DPWELDLDIKEVLVHPNYTRSNSDNDIALLRLSQPATLSKTIVPICL---PNSGLAQ 367

  Fly   159 --WQVYVDTIRYFIITGWGATNASEVSDK-------LQLTRIPQIDRFTCRYWFGYMVDRTHICA 214
              .|...:|    ::|||| ..:.:|.|.       |...|||...|..|......:|....:||
  Rat   368 ELSQAGQET----VVTGWG-YQSDKVKDGRRNRTFILTFIRIPLAARNDCMQVMNNVVSENMLCA 427

  Fly   215 GESKHYVG------KGDSGGPLGSMVDYKYAKRFFQFGIVS------HLRQPFHGVSVFTNILSY 267
            |    .:|      .||||||   ||.: :...:|..|:||      ||    :...|:|.:.||
  Rat   428 G----IIGDTRDACDGDSGGP---MVVF-FRGTWFLVGLVSWGEGCGHL----NNYGVYTKVGSY 480

  Fly   268 SNWIHRTI 275
            ..|||..|
  Rat   481 LKWIHSYI 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 83/262 (32%)
Tryp_SPc 38..274 CDD:238113 85/264 (32%)
ProcXP_008770240.3 GLA 65..125 CDD:214503
EGF_CA 126..170 CDD:238011
FXa_inhibition 178..213 CDD:405372
Tryp_SPc 252..486 CDD:238113 84/263 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.