DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG30288

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:286 Identity:100/286 - (34%)
Similarity:152/286 - (53%) Gaps:30/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLALLILGHGISLGYSYLLEWDCGISK---YTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLL 68
            ::|.|.:|. |......|||.|||.:.   |..||.||||:.:..|||:..:.|:.|.:|||||:
  Fly    10 IVACLFIGI-IRTESGRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGSLI 73

  Fly    69 NHWFVLTAAHCFRDKNAKVLVRLGENDASQKI-DCNESECAAPHLEYMIMQKLIHPLYRTAHYYD 132
            ...|||||.||.......  |||||.|....| ||::..|........:.:|::|    :...||
  Fly    74 TARFVLTAEHCISPMYMN--VRLGEYDTRHPIFDCDDFVCTPRAYNVDVDRKIVH----SNPGYD 132

  Fly   133 IALAKLNRYVVYTDSIRPICLML------NPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRI 191
            |.|.::.|.|::::.:|||||:|      ||.      :|..|..||||..:..|..|:||...:
  Fly   133 IGLLRMQRSVIFSNYVRPICLILGKTLGGNPL------SILRFNFTGWGTNSDGEEQDRLQTATL 191

  Fly   192 PQIDRFTCRYWFGYMVDRTHICAGESKHYVG---KGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQ 253
            .|:.:::|.. .|..:|.::||||.   |:.   ||||||||.::..::...|.||||:.|...:
  Fly   192 QQLPQWSCER-PGRPLDISYICAGS---YISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLR 252

  Fly   254 PFHGVSVFTNILSYSNWIHRTIITNS 279
            ...|:.::||:..:::||...|..:|
  Fly   253 LCSGLGIYTNVTHFTDWILDVIQNHS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 85/243 (35%)
Tryp_SPc 38..274 CDD:238113 86/245 (35%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 85/243 (35%)
Tryp_SPc 45..270 CDD:238113 83/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.