DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG30187

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:258 Identity:87/258 - (33%)
Similarity:133/258 - (51%) Gaps:12/258 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LGYSYLLEWDCGISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDK 83
            :|.|..|:..|||: ...:||||.::....:.|:|.:|..:.|||||:|::..||||||||..|:
  Fly    18 VGASIFLDQICGIN-IALKITGGHNAAFQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQ 81

  Fly    84 NAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHYYDIALAKLNRYVVYTDSI 148
            :.: .|.||..:.|...|..:...|..|..:.:         |.::..||.|.||:..|::...|
  Fly    82 DVQ-SVSLGAYNKSDPADRKDVITAVVHSSFDV---------RASYENDIGLLKLSSDVIFNALI 136

  Fly   149 RPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHIC 213
            ||||::||.:...::..:|.|...|||....::.||.||...:..:||..|............||
  Fly   137 RPICIVLNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREECYMELSVYPSEKQIC 201

  Fly   214 AGESKHYVGKGDSGGPLGSMVDYK-YAKRFFQFGIVSHLRQPFHGVSVFTNILSYSNWIHRTI 275
            ||........|||||||.:.|..: ...|..||||:|..:....|..|:|:::|:::||..||
  Fly   202 AGVPSGDTCGGDSGGPLTNDVFIQGIGNREVQFGIISVGKTSCDGQGVYTDLMSFADWIKMTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 77/234 (33%)
Tryp_SPc 38..274 CDD:238113 79/236 (33%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 77/234 (33%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.