DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG30002

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001163100.1 Gene:CG30002 / 246384 FlyBaseID:FBgn0260474 Length:311 Species:Drosophila melanogaster


Alignment Length:278 Identity:100/278 - (35%)
Similarity:139/278 - (50%) Gaps:31/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GISLGYSYLLEWDCGIS-------KYTYRITGGRDSPLMLNPWLAYLHINSKF---ICGGSLLNH 70
            |..|.|..|.:.|||:.       :..:.|||||.|.||..||:|:|||.|..   .|||||::.
  Fly    33 GQRLVYENLTQQDCGVRSNQIPAVRIRFMITGGRKSSLMSQPWMAFLHIASDLEMCRCGGSLISE 97

  Fly    71 WFVLTAAHCFR--DKNAKVLVRLGENDASQKIDCN----ESECAAPHLEYMIMQKLIHPLYRTAH 129
            .|||||||||:  .::.::.|.|||.|.|...||.    |..||.|..|:.|.:.::|..:...:
  Fly    98 LFVLTAAHCFKMCPRSKEIRVWLGELDLSSTSDCTTYNYERVCAPPVEEFTIDKWILHEEFNLFY 162

  Fly   130 -YYDIALAKLNRYVVYTDSIRPICLMLNPNWQVYVDTI-RYFIITGWGATNASEVSDKLQLTRIP 192
             .|||||.|||:.||:.|.||||||.|......:...: :.|:..|||.|.:...::...     
  Fly   163 PGYDIALIKLNKKVVFKDHIRPICLPLTDELLAFTLQLGQRFMAVGWGKTESLRYANSTM----- 222

  Fly   193 QIDRFTCRYWFGYMVDRTHICAGESKHYVG--KGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPF 255
            ::|..|.:...|.  |.:.:||  |..||.  .|||||||..........|..|||:||...|..
  Fly   223 EVDIRTEKCTDGR--DTSFLCA--SGDYVDTCNGDSGGPLLWKTTLFGKDRAVQFGVVSTGSQNC 283

  Fly   256 HG--VSVFTNILSYSNWI 271
            ..  .:.:.::.:|..||
  Fly   284 GAGHKAYYMDVPTYMPWI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 91/248 (37%)
Tryp_SPc 38..274 CDD:238113 93/249 (37%)
CG30002NP_001163100.1 Tryp_SPc 62..301 CDD:214473 91/247 (37%)
Tryp_SPc 62..301 CDD:238113 91/247 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.