DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and F10

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:253 Identity:72/253 - (28%)
Similarity:132/253 - (52%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGRDSPLMLNPWLAYLHIN--SKFICGGSLLNHWFVLTAAHC-FRDKNAKVLVRLGENDASQ 98
            ||.||::......||.|.| ||  ::..|||::|:.:::|||||| ::.|..|  ||:|:.:..|
Human   234 RIVGGQECKDGECPWQALL-INEENEGFCGGTILSEFYILTAAHCLYQAKRFK--VRVGDRNTEQ 295

  Fly    99 KIDCNESECAAPHLEYMIMQKLIHPLYRTAHY-YDIALAKLNRYVVYTDSIRPICLMLNPNW-QV 161
            :    |...|...:|.:|.    |..:....| :|||:.:|...:.:..::.|.||. ..:| :.
Human   296 E----EGGEAVHEVEVVIK----HNRFTKETYDFDIAVLRLKTPITFRMNVAPACLP-ERDWAES 351

  Fly   162 YVDTIRYFIITGWGATN-ASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAG--ESKHYVGK 223
            .:.|.:..|::|:|.|: ....|.:|::..:|.:||.:|:....:::.:...|||  ..:....:
Human   352 TLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQNMFCAGYDTKQEDACQ 416

  Fly   224 GDSGGPLGSMVDYKYAKRFFQFGIVSH----LRQPFHGVSVFTNILSYSNWIHRTIIT 277
            ||||||..:    ::...:|..||||.    .|:..:|  ::|.:.::..||.|::.|
Human   417 GDSGGPHVT----RFKDTYFVTGIVSWGEGCARKGKYG--IYTKVTAFLKWIDRSMKT 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 68/245 (28%)
Tryp_SPc 38..274 CDD:238113 69/247 (28%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 69/246 (28%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.