DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and F9

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:257 Identity:74/257 - (28%)
Similarity:118/257 - (45%) Gaps:37/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKID 101
            |:.||.|:.....||...|:......||||::|..:::|||||. :...|:.|..||:      :
Human   226 RVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCV-ETGVKITVVAGEH------N 283

  Fly   102 CNESECAAPHLEYM--IMQKLIHPLYRTA---HYYDIALAKLNRYVVYTDSIRPICLMLNPNWQV 161
            ..|:|    |.|..  :::.:.|..|..|   :.:||||.:|:..:|....:.|||:.    .:.
Human   284 IEETE----HTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIA----DKE 340

  Fly   162 YVDTIRYF---IITGWGAT-NASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHYVG 222
            |.:....|   .::|||.. :....:..||..|:|.:||.||.....:.:.....|||  .|..|
Human   341 YTNIFLKFGSGYVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAG--FHEGG 403

  Fly   223 K----GDSGGPLGSMVDYKYAKRFFQFGIVSHLRQ-PFHG-VSVFTNILSYSNWI-HRTIIT 277
            :    ||||||..:.|:    ...|..||:|...: ...| ..::|.:..|.||| .:|.:|
Human   404 RDSCQGDSGGPHVTEVE----GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 70/248 (28%)
Tryp_SPc 38..274 CDD:238113 71/251 (28%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:317114
Tryp_SPc 227..457 CDD:238113 71/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.