DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and Proc

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_006525784.1 Gene:Proc / 19123 MGIID:97771 Length:484 Species:Mus musculus


Alignment Length:262 Identity:82/262 - (31%)
Similarity:117/262 - (44%) Gaps:47/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGRDSPLMLNPWLA-YLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKI 100
            ||..|..:....:||.| .|....|..|||.|::..:|||||||. :...|:.|||||.|..:: 
Mouse   235 RIVNGTLTKQGDSPWQAILLDSKKKLACGGVLIHTSWVLTAAHCV-EGTKKLTVRLGEYDLRRR- 297

  Fly   101 DCNESECAAPH--LEYMIMQKLIHPLY-RTAHYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVY 162
                     .|  |:..|.:.|:||.| |::...||||.:|.:....:.:|.||||..|...|..
Mouse   298 ---------DHWELDLDIKEILVHPNYTRSSSDNDIALLRLAQPATLSKTIVPICLPNNGLAQEL 353

  Fly   163 VDTIRYFIITGWGATNASEVSDK-------LQLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHY 220
            ....:..::|||| ..:..:.|.       |...|||.:.|..|......:|....:|||    .
Mouse   354 TQAGQETVVTGWG-YQSDRIKDGRRNRTFILTFIRIPLVARNECVEVMKNVVSENMLCAG----I 413

  Fly   221 VG------KGDSGGPLGSMVDYKYAKRFFQFGIVS------HLRQPFHGVSVFTNILSYSNWIHR 273
            :|      .||||||   ||.: :...:|..|:||      |.    :...::|.:.||..|||.
Mouse   414 IGDTRDACDGDSGGP---MVVF-FRGTWFLVGLVSWGEGCGHT----NNYGIYTKVGSYLKWIHS 470

  Fly   274 TI 275
            .|
Mouse   471 YI 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 78/256 (30%)
Tryp_SPc 38..274 CDD:238113 80/258 (31%)
ProcXP_006525784.1 GLA 50..110 CDD:214503
EGF_CA 111..155 CDD:238011
FXa_inhibition 163..198 CDD:373209
Tryp_SPc 236..470 CDD:238113 79/257 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.