DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and F9

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:256 Identity:72/256 - (28%)
Similarity:117/256 - (45%) Gaps:35/256 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKID 101
            |:.||.::.....||...|:...:..|||:::|..:::|||||.:..: |:.|..||.:..:|.|
Mouse   236 RVVGGENAKPGQIPWQVILNGEIEAFCGGAIINEKWIVTAAHCLKPGD-KIEVVAGEYNIDKKED 299

  Fly   102 CNESE---CAAPHLEY-MIMQKLIHPLYRTAHYYDIALAKLNRYVVYTDSIRPICLMLNPNWQVY 162
            ..:..   ...||.:| ..:.|..|         ||||.:|::.::....:.|||:..    :.|
Mouse   300 TEQRRNVIRTIPHHQYNATINKYSH---------DIALLELDKPLILNSYVTPICVAN----REY 351

  Fly   163 VDTIRYF---IITGWGAT-NASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHYVGK 223
            .:....|   .::|||.. |....:..||..|:|.:||.||.....:.:.....|||..:.  ||
Mouse   352 TNIFLKFGSGYVSGWGKVFNKGRQASILQYLRVPLVDRATCLRSTTFTIYNNMFCAGYREG--GK 414

  Fly   224 ----GDSGGPLGSMVDYKYAKRFFQFGIVSHLRQ-PFHG-VSVFTNILSYSNWI-HRTIIT 277
                ||||||..:.|:    ...|..||:|...: ...| ..::|.:..|.||| .:|.:|
Mouse   415 DSCEGDSGGPHVTEVE----GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 68/247 (28%)
Tryp_SPc 38..274 CDD:238113 69/250 (28%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:291342
Tryp_SPc 236..464 CDD:214473 68/247 (28%)
Tryp_SPc 237..467 CDD:238113 69/249 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.