DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and F7

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_034302.2 Gene:F7 / 14068 MGIID:109325 Length:446 Species:Mus musculus


Alignment Length:291 Identity:78/291 - (26%)
Similarity:121/291 - (41%) Gaps:74/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEWDCG---------ISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCF 80
            :|:.||         .|....||.||...|....||.|.|.||...:||..||:..:::||||||
Mouse   172 VEYPCGRIPVVEKRNSSSRQGRIVGGNVCPKGECPWQAVLKINGLLLCGAVLLDARWIVTAAHCF 236

  Fly    81 RDKN--AKVLVRLGENDASQKIDCNE-----SECAAPHLEYMIMQKLIHPLYRTAHYYDIALAKL 138
            .:..  ..:.|.:||:|.|:| |.:|     ::...|  :..|..|:.|         ||||.:|
Mouse   237 DNIRYWGNITVVMGEHDFSEK-DGDEQVRRVTQVIMP--DKYIRGKINH---------DIALLRL 289

  Fly   139 NRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWG-ATNASEVSDKLQLTRIPQIDRFTC--- 199
            :|.|.:||.:.|:||......:..:..||:..::||| ..:....:.:|....:|::....|   
Mouse   290 HRPVTFTDYVVPLCLPEKSFSENTLARIRFSRVSGWGQLLDRGATALELMSIEVPRLMTQDCLEH 354

  Fly   200 -------------RYWFGYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVS-- 249
                         .:..|||......|         |||||||..:    .|...::..|:||  
Mouse   355 AKHSSNTPKITENMFCAGYMDGTKDAC---------KGDSGGPHAT----HYHGTWYLTGVVSWG 406

  Fly   250 -------HLRQPFHGVSVFTNILSYSNWIHR 273
                   |       :.|:|.:..|.:|:.|
Mouse   407 EGCAAIGH-------IGVYTRVSQYIDWLVR 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 72/266 (27%)
Tryp_SPc 38..274 CDD:238113 73/269 (27%)
F7NP_034302.2 GLA 24..85 CDD:214503
EGF_CA 87..123 CDD:238011
FXa_inhibition 132..168 CDD:291342
Tryp_SPc 193..427 CDD:214473 72/265 (27%)
Tryp_SPc 194..431 CDD:238113 73/269 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.