DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and F10

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001229297.1 Gene:F10 / 14058 MGIID:103107 Length:493 Species:Mus musculus


Alignment Length:263 Identity:73/263 - (27%)
Similarity:131/263 - (49%) Gaps:44/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGRDSPLMLNPWLAYLHIN--SKFICGGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQK 99
            ||.|||:......||.|.| ||  ::..|||::||.:::||||||..... :..||:|:.: ::|
Mouse   243 RIVGGRECKDGECPWQALL-INEDNEGFCGGTILNEFYILTAAHCLHQAR-RFKVRVGDRN-TEK 304

  Fly   100 IDCNESECAAPHLEYMIMQKLIHPL---------YRTAHYYDIALAKLNRYVVYTDSIRPICLML 155
            .:.||               ::|.:         .|..:.||||:.:|...:.:..::.|.||. 
Mouse   305 EEGNE---------------MVHEVDVVIKHNKFQRDTYDYDIAVLRLKTPITFRMNVAPACLP- 353

  Fly   156 NPNW-QVYVDTIRYFIITGWGATN-ASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTHICAG-ES 217
            ..:| :..:.|.:..|::|:|.|: ....|:.|::..:|.:||.||:....:.:.:...||| |:
Mouse   354 QKDWAESTLMTQKTGIVSGFGRTHEKGRQSNILKMLEVPYVDRNTCKLSTSFSITQNMFCAGYEA 418

  Fly   218 K-HYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSH----LRQPFHGVSVFTNILSYSNWIHRTIIT 277
            | ....:||||||..:    ::...::..||||.    .|:..:|  ::|.:.::..||.|::..
Mouse   419 KLEDACQGDSGGPHVT----RFKNTYYVTGIVSWGEGCARKGKYG--IYTKVTTFLKWIDRSMKA 477

  Fly   278 NSG 280
            ..|
Mouse   478 RVG 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 69/252 (27%)
Tryp_SPc 38..274 CDD:238113 70/254 (28%)
F10NP_001229297.1 GLA 36..97 CDD:214503
EGF_CA 98..134 CDD:238011
FXa_inhibition 141..176 CDD:291342
Tryp_SPc 243..471 CDD:214473 69/252 (27%)
Tryp_SPc 244..473 CDD:238113 70/253 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.