DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and Egfbp2

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_034245.3 Gene:Egfbp2 / 13647 MGIID:95292 Length:261 Species:Mus musculus


Alignment Length:298 Identity:79/298 - (26%)
Similarity:125/298 - (41%) Gaps:69/298 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LILGHGISLGYSYLLEWDCGIS---KYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWF 72
            |||...:|||         ||.   ....|:.||.:......||...::...:.||||.||:..:
Mouse     4 LILFLALSLG---------GIDAAPPLQSRVVGGFNCKKNSQPWQVAVYYQKEHICGGVLLDRNW 59

  Fly    73 VLTAAHCFRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTA--------- 128
            |||||||:.|:..   |.||:|...|:      |.:|.|  .::.:...||.:..:         
Mouse    60 VLTAAHCYVDQYE---VWLGKNKLFQE------EPSAQH--RLVSKSFPHPGFNMSLLMLQTIPP 113

  Fly   129 ---HYYDIALAKLNRYVVYTDSIRPICLML---NPNWQVYVDTIRYFIITGWGATNAS--EVSDK 185
               ...|:.|.:|::....||.::||.|..   .|..:.        :.:|||:...:  :..|.
Mouse   114 GADFSNDLMLLRLSKPADITDVVKPIALPTKEPKPGSKC--------LASGWGSITPTRWQKPDD 170

  Fly   186 LQLTRIPQIDRFTCRYWFGYMVDRTHICAGESKHYVGKG------DSGGPLGSMVDYKYAKRFFQ 244
            ||...|..:....|...:...|....:||||    :|.|      ||||||       ......|
Mouse   171 LQCVFITLLPNENCAKVYLQKVTDVMLCAGE----MGGGKDTCRDDSGGPL-------ICDGILQ 224

  Fly   245 FGIVSHLRQPF--HGV-SVFTNILSYSNWIHRTIITNS 279
             |..|:...|.  .|| :::||::.:::||..|::.|:
Mouse   225 -GTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 67/259 (26%)
Tryp_SPc 38..274 CDD:238113 68/261 (26%)
Egfbp2NP_034245.3 Tryp_SPc 24..253 CDD:214473 67/259 (26%)
Tryp_SPc 25..256 CDD:238113 68/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.