DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG43336

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:263 Identity:100/263 - (38%)
Similarity:150/263 - (57%) Gaps:17/263 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LGYSYLLEWDCGI---SKYTYRITGGRDSPLMLNPWLAYLH-INSKFICGGSLLNHWFVLTAAHC 79
            ||.:..|:..|||   |....|:..|..:.|..:||:|:|| .:.:|||||||:.:..|||||||
  Fly    16 LGSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVLTAAHC 80

  Fly    80 FRDKNAKVLVRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHY------YDIALAKL 138
            |.|: .:::.||||.|..:...|::|.|.     |.| :.::...:|..||      ||||:.:|
  Fly    81 FLDR-TELVARLGEYDREEYEMCHDSYCT-----YRI-EAMVERGFRHRHYNPMTMAYDIAILRL 138

  Fly   139 NRYVVYTDSIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWF 203
            .|.|.|||:|||||::::|.|:.|:|::.....||||.|.:...|.||:...:.:.....||.:.
  Fly   139 YRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDLARKHPEVCRRYA 203

  Fly   204 GYMVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSHLRQPFHGVSVFTNILSYS 268
            ...:.....|||..:..:..||||||:|:::.|..:|||.|.||.|........|||||:::||.
  Fly   204 TLSLTANQFCAGNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVMVSVFTDVMSYV 268

  Fly   269 NWI 271
            :||
  Fly   269 DWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 91/240 (38%)
Tryp_SPc 38..274 CDD:238113 92/241 (38%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 91/240 (38%)
Tryp_SPc 40..271 CDD:238113 90/237 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.