DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and CG43110

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:256 Identity:84/256 - (32%)
Similarity:130/256 - (50%) Gaps:22/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LGYSYLLEWDCGISKYTYRITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDK 83
            |.||..|:..||.:... :|..|.::......::|.:...:..:|||::::..||||.|||   |
  Fly    18 LAYSMFLKQPCGKTPVP-KIISGSNASQQSAQYMAGIFNTTHLLCGGTIIHEDFVLTVAHC---K 78

  Fly    84 NAKVL-VRLGENDASQKIDCNESECAAPHLEYMIMQKLIHPLYRTAHY-YDIALAKLNRYVVYTD 146
            :.:.| ||||..:.:...|           :..:::.:.||.|..:.| .||||.||.|.|::..
  Fly    79 STQTLFVRLGAYNINHPTD-----------QIRVIETIAHPQYSNSTYANDIALVKLERSVIFNL 132

  Fly   147 SIRPICLMLNPNWQVYVDTIRYFIITGWGATNASEVSDKLQLTRIPQIDRFTCRYWFGYMVDRTH 211
            :|:|||:.|:   ......|||:...|||.|..:|.||.||...:.:.:...|..:.|...|...
  Fly   133 NIQPICIHLD---ATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQ 194

  Fly   212 ICAGESKHYVGKGDSGGPLGSMVDYKYAKRF-FQFGIVSHLRQPFHGVSVFTNILSYSNWI 271
            |||...:.....|||||||.|.:.|: .|.| .||||.|:..:..:||.::|::..||.||
  Fly   195 ICATTDQGDTCAGDSGGPLISKITYQ-GKNFDTQFGITSYGTRECNGVGLYTDVSQYSGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 76/236 (32%)
Tryp_SPc 38..274 CDD:238113 78/237 (33%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 76/236 (32%)
Tryp_SPc 36..257 CDD:238113 78/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ4K
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.