DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and f7

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_571894.2 Gene:f7 / 114423 ZFINID:ZDB-GENE-010814-1 Length:433 Species:Danio rerio


Alignment Length:261 Identity:82/261 - (31%)
Similarity:114/261 - (43%) Gaps:43/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGRDSPLMLNPWLAYLHINSKFICGGSLLNHWFVLTAAHCFRDKNAKVL-VRLGENDASQKI 100
            ||.||.:.|....||...|....|..|||.:....::||||||......|.| :..||:|    :
Zfish   195 RIVGGSECPKGHCPWQVLLKYGEKGFCGGVIYKPTWILTAAHCLEKLKVKFLRIVAGEHD----L 255

  Fly   101 DCNESECAAPHLEYMIM--QKLIHPLY--RTAHYYDIALAKLNRYVVYTDSIRPICLMLNPN--- 158
            :.:|.      .|.:|.  |...||.|  .||. .||||.:|...:||:....|:||.|...   
Zfish   256 EVDEG------TEQLIQVDQMFTHPAYVSETAD-SDIALLRLRTPIVYSVYAVPVCLPLREMAER 313

  Fly   159 --WQVYVDTIRYFIITGWGATNASEVSDKLQLTR--IPQIDRFTCRYWFGYMVDRTHICAG--ES 217
              |.|...|     ::|||..:....:.:| |.|  :|:|....|.......:.....|||  |.
Zfish   314 ELWAVSKHT-----VSGWGKRSEDGPTSRL-LRRLLVPRIRTQECVQVSNLTLTSNMFCAGYIEG 372

  Fly   218 KHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSH----LRQPFHGVSVFTNILSYSNWIHRTIITN 278
            :....||||||||.:    :|....|..||||.    .|...:|  ::|.:.:|..||.:|  ||
Zfish   373 RQDSCKGDSGGPLVT----RYRDTAFLLGIVSWGKGCARPGSYG--IYTRVSNYLQWIRQT--TN 429

  Fly   279 S 279
            :
Zfish   430 T 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 77/251 (31%)
Tryp_SPc 38..274 CDD:238113 78/253 (31%)
f7NP_571894.2 GLA 19..82 CDD:214503
EGF_CA 86..121 CDD:238011
FXa_inhibition 131..166 CDD:291342
Tryp_SPc 195..424 CDD:214473 77/251 (31%)
Tryp_SPc 196..427 CDD:238113 78/253 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.