DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33458 and LOC100004411

DIOPT Version :9

Sequence 1:NP_995854.2 Gene:CG33458 / 2768846 FlyBaseID:FBgn0053458 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_001343728.4 Gene:LOC100004411 / 100004411 -ID:- Length:494 Species:Danio rerio


Alignment Length:265 Identity:70/265 - (26%)
Similarity:120/265 - (45%) Gaps:67/265 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGRDSPLMLNPWLAYLHINSKF-ICGGSLLNHWFVLTAAHCFRDKNAKVLVRLGENDASQKI 100
            ||.||:......:||...|....:: .|||||:|..:|:|||||.:.....:.:  |:.| ..:.
Zfish   248 RIVGGQLQRQGGSPWQVLLRREDEYGFCGGSLINQRWVITAAHCLQQTPHHITI--GDYD-KMRP 309

  Fly   101 DCNESECAAPHLEYMIMQKLI-HPLYRTAHYY----DIALAKLNRYVVYTDSIRPICL------- 153
            |.:|.:        :.::|:| ||.|   |.|    ||||..|:..|.......|.||       
Zfish   310 DKDEQK--------ITVEKIIPHPHY---HEYTFDSDIALLYLSSAVTLGPFASPACLPDANLAE 363

  Fly   154 -MLNPNWQVYVDTIRYFIITGWGATNASEVSDK-LQLTRIPQIDRFTC-----------RYWFGY 205
             ::.|..|        .:::|||:|:..:.|.: |:..::|.:::.:|           .:..|:
Zfish   364 RLMKPGEQ--------GLVSGWGSTHYLQRSSRFLRKVQLPVVEQKSCINSTEQIITDNMFCAGF 420

  Fly   206 MVDRTHICAGESKHYVGKGDSGGPLGSMVDYKYAKRFFQFGIVSH----LRQPFHGVSVFTNILS 266
            :::....|.         ||||||.  :|:|:  ..:|..|:||.    ..|..:|  |:|.:.:
Zfish   421 LMEEMDACT---------GDSGGPF--IVNYR--GTWFLTGVVSWGERCASQGKYG--VYTRLGN 470

  Fly   267 YSNWI 271
            |.:||
Zfish   471 YLSWI 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33458NP_995854.2 Tryp_SPc 37..271 CDD:214473 68/263 (26%)
Tryp_SPc 38..274 CDD:238113 69/264 (26%)
LOC100004411XP_001343728.4 GLA 22..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 128..164 CDD:291342
Tryp_SPc 248..475 CDD:214473 68/263 (26%)
Tryp_SPc 249..477 CDD:238113 69/264 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.