DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG14456

DIOPT Version :9

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:167 Identity:35/167 - (20%)
Similarity:74/167 - (44%) Gaps:21/167 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYTKLSLLLTLWLAMQLASKTTAML--EFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKL 63
            :||  ::|:.:.:||...|....|:  :||:|...: |::|...:..|    :.:..:::..:::
  Fly     3 LYT--AVLVPVLMAMCHGSLAEKMMRPKFKDIKFWS-DEKFVSHKVVY----DNSDPHLNFSMEV 60

  Fly    64 LQ-LPVTNAKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPF 127
            .| |...:..|...:..:.:.|.....|.|::.|:::.....|||..:.....:||.|:..:||.
  Fly    61 HQELHDVDIHVEVRITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCPI 125

  Fly   128 NHDIILDKLTAKSVYH-RMTNILPFPEGDYMLQLNWF 163
                      ||..|| ...::....:|.|.:...|:
  Fly   126 ----------AKGRYHWHRIHLKRKLQGSYFINKFWW 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 19/85 (22%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.