DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG13590

DIOPT Version :9

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:163 Identity:44/163 - (26%)
Similarity:82/163 - (50%) Gaps:8/163 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLSLLLTLWLAMQLASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPV 68
            |:.:.....|...|:......|:..|..|::.:|.:....||.||:.:|....:::.:..:: |.
  Fly     4 KVFIFAVSLLVAYLSCGEAPYLKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINVTFVE-PA 67

  Fly    69 TNAKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIIL 133
            .|..|:....::.|||||||::.|.|.|:.::. :..|||...:...:..|.:||:||:      
  Fly    68 RNISVHFKTMKKANGYKPFLFDYTFDACEFMRR-RNQPVAKIIWYMIRNVSTINHTCPY------ 125

  Fly   134 DKLTAKSVYHRMTNILPFPEGDYMLQLNWFTSG 166
            :.|...|.:|::...:|.|.|||:|.::|...|
  Fly   126 EGLQMLSDFHKVDIPVPLPSGDYLLMVDWLFDG 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 27/84 (32%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472336
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.