DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG13589

DIOPT Version :9

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:159 Identity:45/159 - (28%)
Similarity:81/159 - (50%) Gaps:22/159 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVTNAKVNGALFQRH 81
            ||..|.|:       |::.:|.:....||.||:.:||...:::....:: |..|..::..:.::.
  Fly    24 LAKMTNAV-------CKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNIYLHMKMMKKA 80

  Fly    82 NGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIILDKLTAKSVYHRMT 146
            |||||||::.|.|.|:.::. :..|.|...::..|..|.:||:||:      :.|...|.:|.:.
  Fly    81 NGYKPFLFDYTFDACEFMRR-RNQPFAKIVWNMIKNVSTVNHTCPY------EGLQMLSDFHHID 138

  Fly   147 NILPFPEGDYMLQLNW-------FTSGIY 168
            ..:|.|.|||:|.|:|       |.:.:|
  Fly   139 VPVPLPSGDYLLLLDWIFDFKPQFATNVY 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 26/84 (31%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 29/92 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472326
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.