DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG33919

DIOPT Version :9

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:161 Identity:42/161 - (26%)
Similarity:83/161 - (51%) Gaps:12/161 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLSLLLTLWLAM--QLASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQL 66
            ||.|::.|....  || :.|..:.:.|.|.| .|::.......|::|::|.....:::...:: :
  Fly     2 KLVLVVLLGCCFIGQL-TNTQLVYKLKKIEC-LVNRTRVSNVSCHVKAINWNLAVVNMDCFMI-V 63

  Fly    67 PVTNAKVNGALFQR--HNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNH 129
            |:.|..:...:|.:  .|.|||||.::.:..|::::...:.|.....:..||.::|:||||||:.
  Fly    64 PLHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSG 128

  Fly   130 DIILDKLTAKSVYHRMTNILPFPEGDYMLQL 160
            .:|     |:..:...:.:.|||:|.|.:.|
  Fly   129 HLI-----ARDGFLDTSLLPPFPQGFYQVSL 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 25/86 (29%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.