DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG33658

DIOPT Version :10

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster


Alignment Length:151 Identity:76/151 - (50%)
Similarity:112/151 - (74%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVTNAKVNGALFQRHNGYKPFLY 89
            :||.|..|.::.|:.::.|||:||||||||:|:|.::|:|:| :.:.|||..|.|:.||||||||
  Fly    28 IEFTNFKCTSMAKDVADIEYCFLKSVNRTYQYLSTRIKVLKL-LNSLKVNFGLHQQINGYKPFLY 91

  Fly    90 NITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIILDKLTAKSVYHRMTNILPFPEG 154
            |||:|.|:.:||.|.:.||.||:|..:..||:|||||:|||||::|||::::..|:...||||.|
  Fly    92 NITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTSETINSRLPKTLPFPTG 156

  Fly   155 DYMLQLNWFTSGIYRVIFKVF 175
            :||.|..|..:..|||:.|::
  Fly   157 NYMFQTYWIANEKYRVVTKIY 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:461928 47/84 (56%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:461928 43/75 (57%)

Return to query results.
Submit another query.