DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG33771

DIOPT Version :10

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster


Alignment Length:189 Identity:45/189 - (23%)
Similarity:77/189 - (40%) Gaps:40/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLTLWLAMQLASKTTAMLEFKNI----NCEAVDKEFSEFEYCYL-----------KSVNRTYK-Y 56
            ||||:|.:||..||..::....:    |.....|.|..|.....           :.:.|.:| :
  Fly     4 LLTLFLLVQLVFKTEIVVGVSQLFVTGNSSYNPKYFKNFTITIANNTMNMDMHLNRPIQRGFKAH 68

  Fly    57 ISVKLKLLQLPVTNAKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNM 121
            :.:.|:|     .|||...::|.:.:           |.|.:..:.|.|...|:|.|..|. ||.
  Fly    69 VDILLRL-----ANAKNFQSMFSQKS-----------DVCAVTSSVKNSLFKSWFKDMSKN-SNF 116

  Fly   122 NHSCP--FNHDIILDKLTAKSVYHRMTNILPFPEGDYMLQLNWFTSGIYRVIFKVFVSL 178
            .::||  ..|..:.|.....|:.|:.  ::|   |:|..:|.:|.......:|:..:||
  Fly   117 MYNCPVEVGHYYMHDWRMGSSMTHKF--LIP---GEYRGKLTFFYGKYGTKLFEEALSL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:461928 20/86 (23%)
CG33771NP_001027145.3 DM8 80..171 CDD:214778 25/108 (23%)

Return to query results.
Submit another query.