DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG33771

DIOPT Version :9

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster


Alignment Length:189 Identity:45/189 - (23%)
Similarity:77/189 - (40%) Gaps:40/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLTLWLAMQLASKTTAMLEFKNI----NCEAVDKEFSEFEYCYL-----------KSVNRTYK-Y 56
            ||||:|.:||..||..::....:    |.....|.|..|.....           :.:.|.:| :
  Fly     4 LLTLFLLVQLVFKTEIVVGVSQLFVTGNSSYNPKYFKNFTITIANNTMNMDMHLNRPIQRGFKAH 68

  Fly    57 ISVKLKLLQLPVTNAKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNM 121
            :.:.|:|     .|||...::|.:.:           |.|.:..:.|.|...|:|.|..|. ||.
  Fly    69 VDILLRL-----ANAKNFQSMFSQKS-----------DVCAVTSSVKNSLFKSWFKDMSKN-SNF 116

  Fly   122 NHSCP--FNHDIILDKLTAKSVYHRMTNILPFPEGDYMLQLNWFTSGIYRVIFKVFVSL 178
            .::||  ..|..:.|.....|:.|:.  ::|   |:|..:|.:|.......:|:..:||
  Fly   117 MYNCPVEVGHYYMHDWRMGSSMTHKF--LIP---GEYRGKLTFFYGKYGTKLFEEALSL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 20/86 (23%)
CG33771NP_001027145.3 DM8 80..171 CDD:214778 25/108 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447893
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.