DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG33770

DIOPT Version :10

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:83 Identity:22/83 - (26%)
Similarity:34/83 - (40%) Gaps:16/83 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIILDKLTAKSVYHRMTNILPFP 152
            |::.::|.|.:|...|.:....::.:..| :.|....||.|         |...|.|...   |.
  Fly    91 LFSTSIDVCNIVNAAKINLFKKWYKNLLK-YGNFLRQCPLN---------ASHYYLRDWQ---FG 142

  Fly   153 EGDYMLQLNWFTSGIYRV 170
            ||   |...:.|||.||:
  Fly   143 EG---LVPPFITSGSYRL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:461928 16/69 (23%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 22/83 (27%)

Return to query results.
Submit another query.