DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG33922

DIOPT Version :9

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:176 Identity:88/176 - (50%)
Similarity:123/176 - (69%) Gaps:8/176 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLSL-LLTLWLAMQLASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLP 67
            :||: |.|:.|.:       ..|||.||.|..:|.||:.|.||:||||||||||.|:|:|||:.|
  Fly     9 QLSIFLFTIHLVI-------CKLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTP 66

  Fly    68 VTNAKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDII 132
            |:|.|:|.|.|||.|||||||||:|||.|:..|:.:.:||.||||:.||::||:|||||::||||
  Fly    67 VSNVKINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDII 131

  Fly   133 LDKLTAKSVYHRMTNILPFPEGDYMLQLNWFTSGIYRVIFKVFVSL 178
            |||::......::||:||.|.|:|:.:.:|:...|.|....|:..:
  Fly   132 LDKVSISHANTQVTNVLPVPHGNYLYRADWYAYNIKRATVDVYAKI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 48/84 (57%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 47/83 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472052
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.