DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG33137

DIOPT Version :9

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:154 Identity:39/154 - (25%)
Similarity:69/154 - (44%) Gaps:16/154 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVTNAKVNGALFQR--H 81
            |:...:.:.|||.|..| ..||....|:::::|.......:.:.||: |:.|..:...:.::  .
  Fly     8 SEPNIVYKLKNIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILKKDYS 70

  Fly    82 NGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIILDKLTAKSVYHRMT 146
            |.::|||.::.::.|..:....:.|.........:.|||.|||||:.     ..|.|:..|.. .
  Fly    71 NKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYR-----GHLMARGAYLN-E 129

  Fly   147 NILP--FPEGDYMLQL----NWFT 164
            :.||  ||.|.|...:    |:.|
  Fly   130 SYLPNVFPLGFYKFNITIMENYIT 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 23/88 (26%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 24/87 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.