DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG13198

DIOPT Version :9

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster


Alignment Length:175 Identity:60/175 - (34%)
Similarity:92/175 - (52%) Gaps:13/175 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLTLWLAMQLA-SKTTAMLEFKNINCE--AVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVT 69
            |..|:|::.|. |..|.:|:|.|:.|.  ...:..:::|||:||.|.|....:|:|:.|.|||:.
  Fly     7 LYLLFLSVLLQDSMGTRLLKFTNVKCMDLPTSRGLTKYEYCHLKVVRRNQVELSLKVSLFQLPIR 71

  Fly    70 NAKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYS-PVASYFFDTFKEFSNMNHSCPF--NHDI 131
            |.......|||.:||:||:|.|..|.|||:.:..|. ....:.||..::.||.|.:||:  ||  
  Fly    72 NLTTRLQCFQRRDGYRPFMYYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENH-- 134

  Fly   132 ILDKLTAKSVYHRMTNI-LPFPEGDYMLQLNWFTSGIYRVIFKVF 175
                :|.:......|.| :|.|.|.|.|...::..||.|.:.:||
  Fly   135 ----MTVEKFALDFTKISMPVPAGTYRLGFTFYAYGIARTLTQVF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 30/88 (34%)
CG13198NP_610690.1 DM8 86..179 CDD:214778 32/96 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.