DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG33453

DIOPT Version :9

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:138 Identity:41/138 - (29%)
Similarity:80/138 - (57%) Gaps:9/138 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVTNAKVNGALFQRHNGYKPFLY 89
            ::..|:.||:::|.::.|.||.||:.:|....:::....|. |..|..:...:.:|.:||||||:
  Fly    27 IKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLH-PTNNVSLRLKMVKRLSGYKPFLF 90

  Fly    90 NITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIILDKLTAKSVYHRMTNILPFPEG 154
            ::|:|.|:.::. :::||...|:...|::|.:||:||:...::.|       ||.....:|.|.|
  Fly    91 DVTIDACQFLRK-RHNPVIKMFYSFIKDYSTLNHTCPYGLQVVSD-------YHTAVFPVPLPSG 147

  Fly   155 DYMLQLNW 162
            ||.:.|::
  Fly   148 DYGVLLDF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 27/84 (32%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 25/82 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472338
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.