DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG33454

DIOPT Version :9

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:173 Identity:59/173 - (34%)
Similarity:103/173 - (59%) Gaps:12/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLTLWLAMQ-LASKTTAMLEFKNINCEAVDKEFSEFEYCYLKSVNRTYKYISVKLKLLQLPVTN 70
            ::|.:::|:. |....:||::..|:.||:.||..:.|.||.||:.:||...:.:....|. |:.:
  Fly     6 IILGVFVAVVFLVYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHINATFLH-PINS 69

  Fly    71 AKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMNHSCPFNHDIILDK 135
            ..|...:.:|.|||||||::||||.|:.::.|. :||....::..|:.||:|||||:...::.| 
  Fly    70 ISVRFQMLKRANGYKPFLFDITVDACQFLRKPN-NPVIKIVYNMIKDASNINHSCPYGTVVLND- 132

  Fly   136 LTAKSVYHRMTNILPFPEGDYMLQLNWFTSGIYRVIFKVFVSL 178
                  :||::..||||.|||:.:|::..:|  :..|.|.|::
  Fly   133 ------FHRISLPLPFPSGDYLSRLDFLING--KTKFYVNVNM 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 35/84 (42%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 34/83 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472332
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.