DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33463 and CG30050

DIOPT Version :9

Sequence 1:NP_995846.2 Gene:CG33463 / 2768844 FlyBaseID:FBgn0053463 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster


Alignment Length:188 Identity:42/188 - (22%)
Similarity:79/188 - (42%) Gaps:41/188 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 WLAMQLASKTTA-----------MLEFKNINCEAVDKEFSEFEYC-YLKSVNRT-------YKYI 57
            |..:.:.|..||           .:|.|.::|......|:.. || .:...|||       .:.:
  Fly     7 WFGIIVCSLDTADTAKLIPNMGYYIEMKQMDCVGNPNYFANL-YCRIIPPKNRTMEASVNIMQQL 70

  Fly    58 SVKLKLLQLPVTNAKVNGALFQRHNGYKPFLYNITVDCCKLVKNPKYSPVASYFFDTFKEFSNMN 122
            ||....|::.:.|||  ..:.|        :::||.|.||:::..|...:.....:|..:.||..
  Fly    71 SVFSGSLRVSIPNAK--KVITQ--------IFDITFDVCKVLRERKRKILIDLLVNTLAKNSNAK 125

  Fly   123 -HSCPFNHDIILDKLTAKSVYHRMTNILP-FPEGDYMLQLNWFTSGIYRVIFKVFVSL 178
             ..|||..    .|..::::  .:|::.| ..|.::.:.|::|   |.:|...:.|:|
  Fly   126 AWRCPFPK----GKFESRNI--SVTDLPPMLTESEFFVNLDFF---IPKVAIAMNVTL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33463NP_995846.2 DUF1091 73..158 CDD:399471 17/86 (20%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.