DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and TMPRSS13

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001070731.1 Gene:TMPRSS13 / 84000 HGNCID:29808 Length:567 Species:Homo sapiens


Alignment Length:265 Identity:67/265 - (25%)
Similarity:106/265 - (40%) Gaps:51/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERSVNAKLAQN---PWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGE 90
            ||: ..::.|.|...||.:   ||...|.......|.||||:..:|||||||.            
Human   317 CGL-RAMTGRIVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCF------------ 368

  Fly    91 YNTKTKV-------DCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRP 148
            :.|:.||       ...::|.|.|......::.....|.:..|. .||.::||.:.:....||.|
Human   369 FVTREKVLEGWKVYAGTSNLHQLPEAASIAEIIINSNYTDEEDD-YDIALMRLSKPLTLSAHIHP 432

  Fly   149 ICIFASNRFQEPIDQLTW-FTTTVW-------RETAANATSKVLRTMNIDRQPKETCSE--IYGW 203
            .|:        |:...|: ...|.|       ||| .:.||..||.:.::....:.|::  :|..
Human   433 ACL--------PMHGQTFSLNETCWITGFGKTRET-DDKTSPFLREVQVNLIDFKKCNDYLVYDS 488

  Fly   204 NMTFEQICAGNTLS--QLCSTDSGAPQIRKMWHNGSDRYVQLGIAS--RVKGQCQNSGILMDLLS 264
            .:|...:|||:...  ..|..|||.|.:.:.    ::|:...|:.|  ...||....|:...:..
Human   489 YLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQ----NNRWYLAGVTSWGTGCGQRNKPGVYTKVTE 549

  Fly   265 YADWI 269
            ...||
Human   550 VLPWI 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 61/243 (25%)
Tryp_SPc 48..269 CDD:214473 59/241 (24%)
TMPRSS13NP_001070731.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
13 X 5 AA repeats of A-S-P-A-[GLQR] 9..93
4 X 5 AA repeats of T-P-P-G-R 14..68
DUF3682 16..>87 CDD:289231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 131..157
SRCR_2 231..320 CDD:292133 2/3 (67%)
Tryp_SPc 325..554 CDD:214473 63/254 (25%)
Tryp_SPc 326..557 CDD:238113 64/255 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.