DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and prss60.1

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:293 Identity:88/293 - (30%)
Similarity:125/293 - (42%) Gaps:46/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IGIAVICCLWRRVQGFQMLLEEDCGIP--HNISERSVNAKLAQNPWMAYLETP--KGFHCSGTLI 66
            :.:|::.|    |||....|.. ||:.  :|.....|||.....||...|.:|  .|..|.|:||
Zfish     7 VSLALLLC----VQGSHSQLNV-CGLAPLNNRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLI 66

  Fly    67 NHLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFR----HRYYNANDQ 127
            |..:|||||||:|  .:.|..|..:..||        .|:....|.::....    |..||....
Zfish    67 NSEWVLTAAHCLP--RITTSSLLVFLGKT--------TQQGVNTYEINRTVSVITVHPSYNNLTN 121

  Fly   128 TNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSK-VLRTMNIDR 191
            .|||.:|.|...|.:.|:|||:|:.|.|.. .|....:|.|.....:...|..:. :|:...|..
Zfish   122 ENDIALLHLSSAVTFSNYIRPVCLAAQNSV-FPNGTSSWITGWGNIQLGVNLPAPGILQETMIPV 185

  Fly   192 QPKETCSEIYG-WNMTFEQICAGNTLSQ----LCSTDSGAPQIRK---MWHNGSDRYVQLGIASR 248
            .|.:.|:.:.| .::|...||||  |.|    .|..|||.|.:.|   :|       ||.||.|.
Zfish   186 VPNDQCNALLGSGSVTNNMICAG--LLQGGRDTCQGDSGGPMVSKQCLVW-------VQSGITSW 241

  Fly   249 VKGQC---QNSGILMDLLSYADWIKRVVRQYGP 278
            ..| |   .:.|:...:..|..||..::.|..|
Zfish   242 GYG-CADPYSPGVYTRVSQYQSWINSIIVQNLP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 74/241 (31%)
Tryp_SPc 48..269 CDD:214473 72/238 (30%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 75/251 (30%)
Tryp_SPc 34..267 CDD:238113 77/253 (30%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.