DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and f7

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001072819.1 Gene:f7 / 780280 XenbaseID:XB-GENE-5787186 Length:452 Species:Xenopus tropicalis


Alignment Length:269 Identity:72/269 - (26%)
Similarity:116/269 - (43%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CG-IP--HNISERS--VNAKL---AQNPWMAYLETPKGFHCSGTLINHLFVLTAAHC---VPDDL 82
            || ||  .|:::|:  |...:   .:.||.|.|...:.|.|.||||...:|:|||||   :|::.
 Frog   197 CGKIPVLKNVNKRARIVGGDMCPKGECPWQALLMYNEIFICGGTLIAPNWVITAAHCLKPLPENK 261

  Fly    83 LITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYY--NANDQTNDIGMLRLGRRVEYLNH 145
            | ||.|||:...|....:        ||..|.....|.:|  :..:..|||.:|:|...|.|.::
 Frog   262 L-TVVLGEHRIGTPEGTE--------QESKVSKIIMHEHYYGSKTNNDNDIALLKLTTPVNYTDY 317

  Fly   146 IRPICIFASNRFQEPIDQLTWFTTTVW-RETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQ 209
            :.|:|:.......:.:..:.:.|.:.| |...:.||.::|:.:.:.|...:.|......|::...
 Frog   318 VVPLCLPEKQFAVQELLSIRYSTVSGWGRLLESGATPELLQRVQLPRVKTQDCIRQTQMNISQNM 382

  Fly   210 ICAGNT--LSQLCSTDSGAPQIRK-----------MWHNGSDRYVQLGIASRVKGQCQNSGILMD 261
            .|||.|  ....|..|||.|...:           .|..|..:..:.|:.:||.           
 Frog   383 FCAGYTDGSKDSCKGDSGGPHATQYKNTHFLTGIVSWGLGCAKKEKYGVYTRVS----------- 436

  Fly   262 LLSYADWIK 270
              .|.:|||
 Frog   437 --RYTEWIK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 65/242 (27%)
Tryp_SPc 48..269 CDD:214473 62/239 (26%)
f7NP_001072819.1 Gla 67..107 CDD:366184
EGF_CA 108..144 CDD:238011
FXa_inhibition 153..189 CDD:373209
Tryp_SPc 212..445 CDD:238113 66/254 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.