DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and st14b

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_005161261.1 Gene:st14b / 777629 ZFINID:ZDB-GENE-061103-613 Length:864 Species:Danio rerio


Alignment Length:275 Identity:65/275 - (23%)
Similarity:101/275 - (36%) Gaps:59/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPHNISERSVNAKLAQN---PWMAYLE-TPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLG 89
            ||...:.|.|.|..|.:..   ||...|. ..:|..|..::|::.:::||||||.|         
Zfish   615 CGKKPHKSSRIVGGKDSDEGEWPWQVSLHMKTQGHVCGASVISNSWLVTAAHCVQD--------- 670

  Fly    90 EYNTKTKVDCDNHLCQEPFQEYNVDMGFR------------------HRYYNANDQTNDIGMLRL 136
                      ::........::.|.:|..                  |..|:.:...|||.::.|
Zfish   671 ----------NDQFRYSQADQWEVYLGLHNQGETSKSTQRSVLRIIPHPQYDHSSYDNDIALMEL 725

  Fly   137 GRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVW---RETAANATSKVLRTMNIDRQPKETCS 198
            ...|....:|.|||:.....: .|..:..|.|.  |   || .::|...||:...:.......||
Zfish   726 DSPVTLNQNIWPICLPDPTHY-FPAGKSVWITG--WGKLRE-GSDAVPSVLQKAEVRIINSTVCS 786

  Fly   199 EIYGWNMTFEQICAGNTLS---QLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQC---QNSG 257
            ::....:|...|||| .||   ..|..|||.|...   ..|:.|....|:.|...| |   ...|
Zfish   787 KLMDDGITPHMICAG-VLSGGVDACQGDSGGPMSS---IEGNGRMFLAGVVSWGDG-CGRRNRPG 846

  Fly   258 ILMDLLSYADWIKRV 272
            :...:..|..||:.:
Zfish   847 VYTRVTDYRSWIREI 861

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 59/251 (24%)
Tryp_SPc 48..269 CDD:214473 57/248 (23%)
st14bXP_005161261.1 SEA 92..180 CDD:279699
CUB 233..342 CDD:238001
CUB 351..457 CDD:238001
LDLa 465..497 CDD:238060
LDLa 499..533 CDD:238060
LDLa 536..570 CDD:238060
LDLa 578..613 CDD:238060
Tryp_SPc 624..858 CDD:214473 60/261 (23%)
Tryp_SPc 625..861 CDD:238113 61/263 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.