DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and 1810009J06Rik

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_076196.1 Gene:1810009J06Rik / 73626 MGIID:1920876 Length:247 Species:Mus musculus


Alignment Length:254 Identity:57/254 - (22%)
Similarity:96/254 - (37%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IPHNISERSVNAKLAQN---PWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYN 92
            :|.|..::.|.......   |:...|.......|.|:||:..:||:||||....|  .|||||:|
Mouse    16 LPANSDDKIVGGYTCPKHSVPYQVSLNDGISHQCGGSLISDQWVLSAAHCYKRRL--QVRLGEHN 78

  Fly    93 TKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICI---FAS 154
                :|    :.:...|..:.:...||..||.:...|||.:::|.......:.:..:.:   .||
Mouse    79 ----ID----VLEGGEQFIDAEKIIRHPDYNKDTVDNDIMLIKLKSPAILNSQVSTVSLPRSCAS 135

  Fly   155 NRFQEPIDQLTWFTTTVWRETAA--NATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAG--NT 215
            ...|        ...:.|..|.:  .....:|:.:........:|.:.|...:|....|.|  ..
Mouse   136 TNAQ--------CLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEG 192

  Fly   216 LSQLCSTDSGAPQIRKMWHNGS-DRYVQLGIASRVKGQCQNSGILMDLLSYADWIKRVV 273
            ....|..|||.|.:    .||. ...|..|....::|:   .|:...:.:|..||:..:
Mouse   193 GKDSCDGDSGGPVV----CNGEIQGIVSWGSVCAMRGK---PGVYTKVCNYLSWIQETM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 54/231 (23%)
Tryp_SPc 48..269 CDD:214473 52/228 (23%)
1810009J06RikNP_076196.1 Tryp_SPc 23..240 CDD:214473 53/241 (22%)
Tryp_SPc 24..243 CDD:238113 55/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.