DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and XB5723326

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001037931.1 Gene:XB5723326 / 733551 XenbaseID:XB-GENE-5723327 Length:349 Species:Xenopus tropicalis


Alignment Length:277 Identity:63/277 - (22%)
Similarity:121/277 - (43%) Gaps:52/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PWMAYLE--TPKGFH--CSGTLINHLFVLTAAHCVPD-----------DLLITVRLGEYNTKTKV 97
            ||:..::  ...|:.  |:||::|:.:::|||||..|           .||.|..|.|...:|  
 Frog    28 PWIVSIQKKVELGYKHICAGTILNNEWIITAAHCFKDWKEGDPTTPLRVLLGTFYLSEIGLRT-- 90

  Fly    98 DCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICI-FASNRFQEPI 161
                       |...|....:|..|:...::|||.:::|.::||:.:||:..|. ..|...::.|
 Frog    91 -----------QSRGVKQLIKHDQYDPITESNDIALIQLDKQVEFSDHIQQACFPKESADLKDLI 144

  Fly   162 DQLTWFTTTVW--RETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTL--SQLCST 222
            |    .:...|  :....:..|:.|:...::|...:.|::.|...:....:|||:..  .:.|:.
 Frog   145 D----CSIAGWGAQGKHLDEPSQFLQEAQVERIDTKHCNKWYQGILGENHLCAGHRKGPEKTCNG 205

  Fly   223 DSGAPQIRKMWHNGSDRYVQLGIASRVK--GQCQNSGILMDLLSYADWIKRVVRQYGPSTDMNRS 285
            |.|:|.:.:...|  :.|..:||.:...  ||.::.|:...:.|:..||...|:        |.:
 Frog   206 DRGSPLMCRTKKN--NVYSVIGILNWGSGCGQTRSPGVYSPIQSHIKWIVEKVK--------NEA 260

  Fly   286 LKKWVD---KIPVFYYP 299
            :|..:.   .:|...:|
 Frog   261 VKATIQGKRLVPKLLFP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 58/245 (24%)
Tryp_SPc 48..269 CDD:214473 56/242 (23%)
XB5723326NP_001037931.1 Tryp_SPc 25..252 CDD:214473 56/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.