DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Prss55

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:342 Identity:80/342 - (23%)
Similarity:130/342 - (38%) Gaps:81/342 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IAVICCLWRRVQGFQM-----------LLEEDCGIPHNISER--------SVNAKLAQNPWMAYL 53
            :|.:|    |:.|..:           :...:||:......|        ...|:|.:.||...:
Mouse    18 LATLC----RLVGHHIRDCILTECLLCIASSECGVRPLYDSRIQYSRIIEGQEAELGEFPWQVSI 78

  Fly    54 ETPKGFHCSGTLINHLFVLTAAHCV------PDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYN 112
            :......|.|::::..::||.|||.      |.||  .||:|          .|.|...|. |..
Mouse    79 QESDHHFCGGSILSEWWILTVAHCFYAQELSPTDL--RVRVG----------TNDLTTSPV-ELE 130

  Fly   113 VDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRET-- 175
            |....||:.:...:..|||.:|.|.:.:.:.....|||:        |:    |.....|.|.  
Mouse   131 VTTIIRHKGFKRLNMDNDIALLLLAKPLTFNELTVPICL--------PL----WPAPPSWHECWV 183

  Fly   176 ----AANATSKVLRTMNIDRQPK-----ETCSEIYGWNMTFEQICA--GNTLSQLCSTDSGAPQI 229
                ..|:|.|...:.::.:.|.     |.|.:::. ::|...:||  ||.....|..|||.|.:
Mouse   184 AGWGVTNSTDKESMSTDLMKVPMRIIEWEECLQMFP-SLTTNMLCASYGNESYDACQGDSGGPLV 247

  Fly   230 RKMWHNGSDRYVQLGIASRVK--GQCQNSGILMDLLSYADWIKRVVRQYGPSTD---MNRSLKK- 288
              ...:...|:.|:||.|..|  |:....||...|..|..||:::.:..|...|   .:.|.|| 
Mouse   248 --CTTDPGSRWYQVGIISWGKSCGKKGFPGIYTVLAKYTLWIEKIAQTEGKPLDFRGQSSSNKKK 310

  Fly   289 -----WVDKIPVFYYPK 300
                 .:.|.|....|:
Mouse   311 NRQNNQLSKSPALNCPQ 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 63/244 (26%)
Tryp_SPc 48..269 CDD:214473 61/241 (25%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 63/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.