DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and Prss56

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:282 Identity:71/282 - (25%)
Similarity:108/282 - (38%) Gaps:37/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPH----NISE---RSVNAKLAQN---PWMAYLETPKGFHCSGTLINHLFVLTAAHC---VPD 80
            ||..|    |.:.   |.|....|.:   ||:..|:......|.|.|:...:|||||||   ..:
Mouse    93 CGERHQGVANTTRAHGRIVGGSTAPSGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASN 157

  Fly    81 DLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNH 145
            :||.||.|.|...           .|..:|..|:....|..::.....||:.:::|...|.....
Mouse   158 ELLWTVMLAEGPQ-----------GEQAEEVQVNRILPHPKFDPQTFHNDLALVQLWTPVSPEGP 211

  Fly   146 IRPICIFASNRFQEPIDQLTWFTTTVWRETAANA-TSKVLRTMNIDRQPKETCSEIYGWNM-TFE 208
            .||||:...:|  || ...|......|.....:. .|:.:|...:.....:||.::.|..: ...
Mouse   212 ARPICLPQGSR--EP-PAGTPCAIAGWGALFEDGPESEAVREARVPLLSADTCQKVLGPGLRPST 273

  Fly   209 QICAGNTLSQL--CSTDSGAPQIRKMWHNGSDRYVQLGIASRVK--GQCQNSGILMDLLSYADWI 269
            .:|||.....:  |..|||.| :.........|.|..|:.|...  |:....|:...:..:.||:
Mouse   274 MLCAGYLAGGIDSCQGDSGGP-LTCSEPGPRPREVLFGVTSWGDGCGEPGKPGVYTRVTVFKDWL 337

  Fly   270 KRVVRQYGPST--DMNRSLKKW 289
            :..: ..||||  ...|.|..|
Mouse   338 QEQM-SAGPSTREPSCRELLNW 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 57/232 (25%)
Tryp_SPc 48..269 CDD:214473 56/229 (24%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 58/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.