DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG34171

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:281 Identity:66/281 - (23%)
Similarity:124/281 - (44%) Gaps:49/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 MLLEEDCGIPHNISERSVN-----------AKLAQNPWMAYLETPKGFH-CSGTLINHLFVLTAA 75
            :||:....:|.||:...:|           :.|.......|:.||...| |:|.::.:..|||:|
  Fly     7 LLLKIALVLPKNITTIKINHYHEPTYSHLSSYLVSLRTRKYIHTPGDNHFCTGVILTNRHVLTSA 71

  Fly    76 HCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPF-----QEYNVDMG--FRHRYYNANDQTNDIGM 133
            ||:.|      :.|...:..::..  .||...|     :|:.||:.  ..|.||:.| |.|||.:
  Fly    72 HCITD------KNGVMMSPKRIVV--ALCASLFKTPESEEFVVDIHNMIIHPYYHRN-QHNDIAI 127

  Fly   134 LRLGRRVEY-LNHIRPICIFASNRFQEPIDQLT-WFTTTVWRETAANATSKVLRTMNIDRQPKET 196
            ::|.|.|:. .:|:.|: :..::..:...|..| .....|.|:...:..|.:|  :|::.:|.:.
  Fly   128 IKLKRYVKLDGHHLAPV-VLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHSMLL--VNVELRPFDE 189

  Fly   197 CSEIYGWNMTF-----EQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS 256
            |.::....|..     :.||..:|..|:|:||.|.|    ::.:|....:.||..:     |.:.
  Fly   190 CLKVKKSLMAARPENEDLICVKSTEKQMCTTDFGGP----LFCDGQLYGIALGSIN-----CSSP 245

  Fly   257 G--ILMDLLSYADWIKRVVRQ 275
            .  ...|:..|..|:.:::.:
  Fly   246 DPVFFSDVSFYNSWVTKIISE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 59/240 (25%)
Tryp_SPc 48..269 CDD:214473 58/237 (24%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 59/251 (24%)
Tryp_SPc 38..263 CDD:304450 60/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.