DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and CG34437

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001097955.1 Gene:CG34437 / 5740179 FlyBaseID:FBgn0085466 Length:266 Species:Drosophila melanogaster


Alignment Length:276 Identity:76/276 - (27%)
Similarity:124/276 - (44%) Gaps:48/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ICCLWRRV---QGFQMLLEEDCGIPHNISERSVNAK-----LAQNPWMAYLETPKGFHCSGTLIN 67
            :|.|:..|   ||....|:.:|          ||.|     ..:.||||::.:|.. :|||||||
  Fly     6 LCFLFTLVLAHQGSAYFLDFEC----------VNHKPHQDVFKETPWMAFIASPTK-NCSGTLIN 59

  Fly    68 HLFVLTAAHCVPDDLLITVRLGEYNTKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIG 132
            ..:|:|.|.||.|....||.||.::...:       .:..:.:::|...:.|:.||.....:||.
  Fly    60 KQYVITTASCVFDQSESTVFLGRFDNIPQ-------NRNRYVKHSVQSVYTHKLYNKQTFEHDIA 117

  Fly   133 MLRLGRRVEYLNHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATSKV----LRTMNIDRQP 193
            :|.|...|.:...|:||||:...     |..|....:..|     ..:.|:    :.|:.|.:..
  Fly   118 LLLLDDPVTFKMSIQPICIWLGE-----ITNLNHLESNRW-----GLSEKMIFQRINTVKILKIK 172

  Fly   194 KETCSEIYGWNMTFEQICAGNTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIAS-RVKGQCQNSG 257
            |  |.:.:|..:...|||||.....:| |::|:..::::.::|......:||.| .|..:|    
  Fly   173 K--CRDSFGITLKKSQICAGFQNGNIC-TETGSSLVKQIHYSGKLWNTLIGIQSYGVSERC---- 230

  Fly   258 ILMDLLSYADWIKRVV 273
            |...:..|.|||..||
  Fly   231 IYNKIAHYIDWIVGVV 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 64/228 (28%)
Tryp_SPc 48..269 CDD:214473 62/225 (28%)
CG34437NP_001097955.1 Tryp_SPc 39..242 CDD:214473 62/227 (27%)
Tryp_SPc 39..242 CDD:304450 62/227 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.