DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33462 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:277 Identity:73/277 - (26%)
Similarity:108/277 - (38%) Gaps:63/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGIPH-NISER---SVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDL--LITVR 87
            ||.|: .::.|   .|||.....|||..|:...|..|.|:|||:.:|||||||:.|..  .|.|.
Zfish    25 CGRPNPTLNPRIVGGVNATHGAWPWMVSLQGRYGHFCGGSLINNQWVLTAAHCIVDQTPSSIIVY 89

  Fly    88 LGEYNTKTKVDCDNHLCQEPFQEYNVDMG---------FRHRYYNANDQTNDIGMLRLGRRVEYL 143
            ||::                 :.|..|:.         ..|..|:...:.|||.:|:|...|:|.
Zfish    90 LGKW-----------------RSYVADVNSISRTIRHIIPHPSYSNITKDNDIALLQLTSTVQYT 137

  Fly   144 NHIRPICIFASNRFQEPIDQLTWFTTTVWRETAANATS---------------KVLRTMNIDRQP 193
            ::|:|||: |......|....:|  ...|.:.....|.               .:|:...:....
Zfish   138 DYIKPICL-ADENSNFPRGTNSW--VAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYS 199

  Fly   194 KETCSEIYGWNMTFEQICAGNTL--SQLCSTDSGAPQIRK--MWHNGSDRYVQLGIASRVKGQCQ 254
            ...|:.|....:|...||||...  ....|.|||.|.:.|  :|       ||.|:.|...|..|
Zfish   200 NADCNNICHGRITPNMICAGTRPGGKATFSGDSGGPLMTKCSVW-------VQAGVLSHGYGCAQ 257

  Fly   255 NS--GILMDLLSYADWI 269
            .:  .:.:.:..|..||
Zfish   258 PNLPEVFIRVSEYKQWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 66/254 (26%)
Tryp_SPc 48..269 CDD:214473 64/252 (25%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 67/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.